PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc004991.1_g00002.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NF-YB
Protein Properties Length: 159aa    MW: 17118.9 Da    PI: 4.7309
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc004991.1_g00002.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB79.44.8e-2528922892
                    NF-YB 28 skdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92
                              ++aketvq+cv+efi +vt++a++++++e+rkt+++ddl+wa+  lG+  y+++l+ +++ yr 
  Itr_sc004991.1_g00002.1 28 RDEAKETVQKCVTEFIHYVTAKANERAKQERRKTVTTDDLIWAMRALGLGSYAQELTDFITDYRA 92
                             689************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF471132.58E-192893IPR009072Histone-fold
Gene3DG3DSA:1.10.20.103.2E-242995IPR009072Histone-fold
PfamPF008083.8E-142971IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006155.2E-63553No hitNo description
PRINTSPR006155.2E-65472No hitNo description
PRINTSPR006155.2E-67391No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    Send to blast
MNADDNTNAN MNADNAAAAG YPEIGSDRDE AKETVQKCVT EFIHYVTAKA NERAKQERRK  60
TVTTDDLIWA MRALGLGSYA QELTDFITDY RAKHVHGRAA THLLPPPPVQ QVPFMQGFPV  120
PGFAPGPMND GAGGSASSSS PLGGDYFLDP SYPPTNFDG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B2e-1712911291Transcription factor HapC (Eurofung)
4g92_B2e-1712911291Transcription factor HapC (Eurofung)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G21970.14e-21NF-YB family protein